| Product Name | Prostatic Acid Phosphatase (248-286), PAP (248-286) |
| Purity | HPLC>95% |
| Description | Prostatic acid phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of a viral infection factor (SEVI) found in semen. This peptide greatly increases HIV infection by enhancing the binding of viral ions to target cells. |
| Storage | -20°C |
| References | |
| Molecular Weight | 4551.5 |
| Sequence (One-Letter Code) | GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
| Sequence (Three-Letter Code) | H - Gly - Ile - His - Lys - Gln - Lys - Glu - Lys - Ser - Arg - Leu - Gln - Gly - Gly - Val - Leu - Val - Asn - Glu - Ile - Leu - Asn - His - Met - Lys - Arg - Ala - Thr - Gln - Ile - Pro - Ser - Tyr - Lys - Lys - Leu - Ile - Met - Tyr - OH |
Prostatic Acid Phosphatase (248-286), PAP (248-286)Admin2021-01-13T09:32:23+00:00
