| Product Name | Intermedin-53 (human) |
| Purity | HPLC>95% |
| Description | Intermedin-53 (human) acts as an important regulator of mean arterial blood pressure and heart rate through its central and peripheral effects. It shows cardioprotection against myocardial ischemia/reperfusion injury. |
| Storage | -20°C |
| References | Y.-S.Ren et al., Peptides, 27, 74 (2006)J.-H.Yang et al., Biochem. Biophys. Res. Commun., 327, 713 (2005) |
| Molecular Weight | 5791.57 |
| Sequence (One-Letter Code) | HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH₂ |
| Sequence (Three-Letter Code) | H-His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond) |
Intermedin-53 (human)Admin2021-01-17T12:30:30+00:00
