| Product Name | Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled |
| Purity | HPLC>95% |
| Description | This is the fluorescent GLP-1 labeled with FAM at the c-terminus of the peptide, Abs/Em=494/521 nm. In small intestinal L cells, proglucagon is cleaved into GLP-1 (1-36) due to glucose uptake. Before secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and a small amount of glycine-extended GLP-1 (7-37). Both GLP-1(7-36) and GLP-1(7-37) can cause glucose-dependent release of insulin by pancreatic cells. They also inhibit gastric motility (gastric emptying), suppress plasma glucagon levels (glucose production), and may play a role in promoting satiety and stimulating glucose processing in peripheral tissues, independent of insulin. GLP-1 polypeptides such as GLP-1 (1-36) have been used to study the recovery of pancreatic cell function. GLP-1 is also produced in the central nervous system |
| Storage | -20°C |
| References | Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7. |
| Molecular Weight | 4469.8 |
| Sequence (One-Letter Code) | FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Sequence (Three-Letter Code) | FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2 |
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeledAdmin2021-01-07T08:44:35+00:00
