| Product Name | Glucagon (1-37), Oxyntomodulin, porcine |
| Purity | HPLC>95% |
| Description | After nutrient intake, GLP-1 and Oxyntomodulin (OXM) are both processed by proglucagon and secreted by polydine-1 cells in the intestine. Oxyntomodulin (OXM) is a 37-amino acid peptide hormone that can cause weight loss in humans and rodents. It activates the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). Its sequence is the same as glucagon (1-29), but with an extra KRNKNNIA c-terminal sequence. |
| Storage | -20°C |
| References | Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001 |
| Molecular Weight | 4421.9 |
| Sequence (One-Letter Code) | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Sequence (Three-Letter Code) | H - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - Lys - Arg - Asn - Lys - Asn - Asn - Ile - Ala - OH |
Glucagon (1-37), Oxyntomodulin, porcineAdmin2021-01-07T07:28:09+00:00
