Product Name | Gastrin Releasing Peptide, human |
Purity | HPLC>95% |
Description | Gastrin releasing peptide (Gastrin releasing peptide, referred to as Gastrin releasing peptide) is a 27-amino acid peptide isolated from the intestine, which can stimulate the release of gastrin. It shares the same C-terminal decapeptide with bombesin. Source. Gastrin releasing peptide is an important growth regulator in the development of lung epithelium. It is used as a tumor marker for the diagnosis of small cell lung cancer because it is known to be produced by these cancer cells. |
Storage | -20°C |
References | Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11.7.1267 Taché, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994) Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009 Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x. |
Molecular Weight | 2859.4 |
Sequence (One-Letter Code) | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
Sequence (Three-Letter Code) | H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2 |
Gastrin Releasing Peptide, humanAdmin2021-01-08T02:44:49+00:00