| Product Name | Calcitonin, human |
| Purity | HPLC>95% |
| Description | Human calcitonin stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease. |
| Storage | -20°C |
| References | Raddino, R. et al. J. Cardiovas. Pharmacol. 29, 463 (1997); Rotella, C. et al. Eur. J. Pharmacol. 107, 347 (1985); Moriarty, et al. Biochem Biophys Res. Commun. 245, 344 (1998); Chen, W. et al. Mol. Pharmacol. 52, 1164 (1997). |
| Molecular Weight | 3417.9 |
| Sequence (One-Letter Code) | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7) |
| Sequence (Three-Letter Code) | H - Cys - Gly - Asn - Leu - Ser - Thr - Cys - Met - Leu - Gly - Thr - Tyr - Thr - Gln - Asp - Phe - Asn - Lys - Phe - His - Thr - Phe - Pro - Gln - Thr - Ala - Ile - Gly - Val - Gly - Ala - Pro - NH2 (Disulfide bridge: 1 - 7) |
Calcitonin, humanAdmin2021-01-05T13:17:17+00:00
