| Product Name | Big Endothelin-1 (1-38), human |
| Purity | HPLC>95% |
| Description | Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides. |
| Storage | -20°C |
| References | Fecteau; M. et al. Hypertension 46, 87 (2005). |
| Molecular Weight | 4283.0 |
| Sequence (One-Letter Code) | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11) |
| Sequence (Three-Letter Code) | H - Cys - Ser - Cys - Ser - Ser - Leu - Met - Asp - Lys - Glu - Cys - Val - Tyr - Phe - Cys - His - Leu - Asp - Ile - Ile - Trp - Val - Asn - Thr - Pro - Glu - His - Val - Val - Pro - Tyr - Gly - Leu - Gly - Ser - Pro - Arg - Ser - OH (Disulfide bridge: 1 - 15 and 3 - 11) |
Big Endothelin-1 (1-38), humanAdmin2021-01-04T12:01:42+00:00
