| Product Name | Adrenomedullin (human) |
| Purity | HPLC>95% |
| Description | Adrenomedullin (ADM) causes an effective and long-lasting blood pressure reduction effect and is considered to be a hormone involved in blood pressure control. In addition, ADM acts as a protective factor for blood vessels. Adrenomedullin is an effective stimulator of osteoblast activity. Other biological activities of hADM include reducing oxidative stress and inhibiting endothelial cell apoptosis. |
| Storage | -20°C |
| References | E.Zudaire et al., J. Leukoc. Biol., 80, 237 (2006)J.Kato et al., Arterioscler. Thromb. Vasc. Biol., 25, 2480 (2005)J.P.Hinson et al., Endocr. Rev., 21, 138 (2000)J.Cornish et al., Am. J. Physiol., 273, E1113 (1997)K.Kitamura et al., Biochem. Biophys. Res. Commun., 192, 553 (1993) |
| Molecular Weight | 6028.82 |
| Sequence (One-Letter Code) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ |
| Sequence (Three-Letter Code) | H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt (Disulfide bond) |
Adrenomedullin (human)Admin2021-01-17T12:32:43+00:00
