| Product Name | (Val³⁴)-Amyloid β-Protein (1-40) |
| Purity | HPLC>95% |
| Description | Cerebral amyloid angiopathy (CAA) is a common finding in Alzheimer’s disease in which amyloid-Aβ vascular deposits are featured in >80% of the cases. Mutations in the positions 21-23 (e.g. Dutch mutation E22Q) are primarily associated with CAA, although they manifest with strikingly different clinical phenotypes: cerebral hemorrhage or dementia. The Piedmont L34V Aβ mutant, located outside this hot spot, shows a similar hemorrhagic phenotype, albeit less aggressive than the widely studied Dutch variant. |
| Storage | -20°C |
| References | S.Fossati et al., FASEB J., 24, 229 (2010) L.Obici et al., Ann. Neurol., 58, 639 (2005) |
| Molecular Weight | 4315.84 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVGGVV |
| Sequence (Three-Letter Code) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Val-Met-Val-Gly-Gly-Val-Val-OH |
(Val³⁴)-Amyloid β-Protein (1-40)Admin2020-12-18T11:53:03+00:00
