| Product Name | [Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, Human |
| Purity | HPLC>95% |
| Description | This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside. |
| Storage | -20°C |
| References | Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001). |
| Molecular Weight | 4442.1 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gly - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
[Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, HumanAdmin2020-12-18T13:20:20+00:00
