| Product Name | Beta-Amyloid (1-40)-Cys, Human |
| Purity | HPLC>95% |
| Description | This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus. |
| Storage | -20°C |
| References | |
| Molecular Weight | 4433.0 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Cys - OH |
Beta-Amyloid (1-40)-Cys, HumanAdmin2020-12-18T12:50:33+00:00
