| Product Name | [Arg6]-beta-Amyloid (1-42), English Mutation, Human |
| Purity | HPLC>95% |
| Description | This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age. |
| Storage | -20°C |
| References | Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007). |
| Molecular Weight | 4533.2 |
| Sequence (One-Letter Code) | DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - Arg - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
[Arg6]-beta-Amyloid (1-42), English Mutation, HumanAdmin2020-12-18T12:23:43+00:00
