| Product Name | Amyloid β-Protein (1-43) |
| Purity | HPLC>95% |
| Description | The amyloid β-protein is a 39- to 43-amino acid polypeptide that is the primary constituent of senile plaques and cerebrovascular deposits in Alzheimer's disease and Down's syndrome. Additionally it acts as an inhibitor of the ubiquitin-dependent protein degradation in vitro. |
| Storage | -20°C |
| References | L.Gregori et al., J. Biol. Chem., 270, 19702 (1995) C.J.Pike et al., J. Neurosci., 13, 1676 (1993) B.A.Yankner et al., Science, 250, 279 (1990) D.Goldgaber et al., Science, 235, 877 (1987) |
| Molecular Weight | 4615.21 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT |
| Sequence (Three-Letter Code) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-OH |
Amyloid β-Protein (1-43)Admin2020-12-18T12:33:52+00:00
