Product Name | Amylin (1-37), rat, mouse |
Purity | HPLC>95% |
Description | Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers. |
Storage | -20°C |
References | Westermark, P. et al. Proc Natl Acad Sci U S A 87, 5036 (1990); Williamson, JA. and AD. Miranker. Protein Sci 16, 110 (2007). doi: 10.1110/ps.062486907. |
Molecular Weight | 3920.5 |
Sequence (One-Letter Code) | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7) |
Sequence (Three-Letter Code) | H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 (Disulfide bridge: 2 - 7) |
Other Products
Related Products