| Product Name | Adrenomedullin (13-52) (human) |
| Purity | HPLC>95% |
| Description | The adrenomedullin fragment has vasodilator activity. It has been proposed to modulate receptor-mediated rather than voltage-dependent pulmonary vasoconstriction by affecting Ca 2+ influx. Therefore, hADM (13-52) has been proposed as an endothelium-dependent vasodilator in the pulmonary vascular bed of rats. In addition, the compound can act as a modulator of the inflammatory vascular stage. |
| Storage | -20°C |
| References | D.Q.Chu et al., Br. J. Pharmacol., 130, 1589 (2000)A.L.Hyman et al., Am. J. Physiol., 274, H1218 (1998)B.Gumusel et al., Am. J. Physiol., 274, H1255 (1998)M.Sone et al., Peptides, 18, 1125 (1997)J.Heaton et al., Am. J. Heart Physiol., 268, H2211 (1995) |
| Molecular Weight | 4533.13 |
| Sequence (One-Letter Code) | SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ |
| Sequence (Three-Letter Code) | H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ (Disulfide bond) |
Adrenomedullin (13-52) (human)Admin2021-01-17T12:37:13+00:00
