| Product Name | ACTH (1-39) (mouse, rat） |
| Purity | HPLC>95% |
| Description | ACTH (1-39) is a member of the melanocortin receptor agonist, which stimulates the adrenal cortex and the secretion of glucocorticoids (such as cortisol). |
| Storage | -20°C |
| References | J.Drouin et al., FEBS Lett., 193, 54 (1985)E.Oates and E.Herbert, J. Biol. Chem., 259, 7421 (1984)J.Drouin and H.M.Goodman, Nature, 288, 610 (1980) |
| Molecular Weight | 4582.23 |
| Sequence (One-Letter Code) | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Sequence (Three-Letter Code) | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
ACTH (1-39) (mouse, rat）Admin2021-01-17T11:22:12+00:00
