| Product Name | Parathyroid Hormone (1-34), human |
| Purity | HPLC>95% |
| Description | Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH related peptide (PTHrP) play an important role in calcium homeostasis of bone, kidney, breast and placenta. They signal through PTH / PTHrP and PTH2 receptors. PTH (1-34) administration can inhibit cardiovascular calcification and down regulate aortic osteogenesis driven by diabetes and dyslipidemia. |
| Storage | -20°C |
| References | Ref: Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984). |
| Molecular Weight | 4117.8 |
| Sequence (One-Letter Code) | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Sequence (Three-Letter Code) | H - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH |
Parathyroid Hormone (1-34), humanAdmin2021-01-16T05:21:10+00:00
