| Product Name | OVA (241-270) |
| Purity | HPLC>95% |
| Description | The peptide is ova peptide residues 241 to 270. Ova peptide is a class I (KB) restricted peptide epitope of ovalbumin, which is presented by class I MHC (major histocompatibility complex) molecule H-2Kb (mouse MHC class I gene). |
| Storage | -20°C |
| References | Mareeva, T. et al. J Biol Chem 279, 44243 (2004). |
| Molecular Weight | 3421.9 |
| Sequence (One-Letter Code) | SMLVLLPDEVSGLEQLESIINFEKLTEWTS |
| Sequence (Three-Letter Code) | H - Ser - Met - Leu - Val - Leu - Leu - Pro - Asp - Glu - Val - Ser - Gly - Leu - Glu - Gln - Leu - Glu - Ser - Ile - Ile - Asn - Phe - Glu - Lys - Leu - Thr - Glu - Trp - Thr - Ser - OH |
OVA (241-270)Admin2021-01-15T10:31:02+00:00
