| Product Name | Des-gamma-carboxylated Osteocalcin/Bone Gla Protein |
| Purity | HPLC>95% |
| Description | The peptide is decorboxylated osteocalcin / bone gla protein (BGP). Osteocalcin / BGP is the highest content of non collagen in bone extracellular matrix, which is secreted by osteoblasts. The peptide was used as a substrate for vitamin K-dependent carboxylase, which modified glu17, glu21 and glu24 to Glu residues. |
| Storage | -20°C |
| References | Houben, R. et al. Biochem J 364, 323 (2002); Ducy, P. et al. Nature 382, 448 (1996); Benton, ME. et al. Biochem 37, 13262 (1995); Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991); Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985). |
| Molecular Weight | 5797.5 |
| Sequence (One-Letter Code) | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29) |
| Sequence (Three-Letter Code) | H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - Arg - Arg - Phe - Tyr - Gly - Pro - Val - OH (Disulfide bridge:C23 - 29) |
Des-gamma-carboxylated Osteocalcin/Bone Gla ProteinAdmin2021-01-15T10:25:15+00:00
