| Product Name | Secretoneurin |
| Purity | HPLC>95% |
| Description | This peptide is a fragment of amino acids 154 to 186 of secretagogue II and is called secretagogue. Secretory neurourea is a neuropeptide produced in the brain, adrenal medulla and other endocrine tissues through proteolysis of secretory secretin II. Secreted neurourea acts as a direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and Akt pathway. |
| Storage | -20°C |
| References | Kirchmair R, et al. Neurosci. 53, 359 (1993); Kirchmair R, et al. Circulation 110, 1121 (2004); Fälth, M. et al. Mol. Cell. Proteom. 5, 998 (2006). |
| Molecular Weight | 3652.0 |
| Sequence (One-Letter Code) | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Sequence (Three-Letter Code) | H - Thr - Asn - Glu - Ile - Val - Glu - Glu - Gln - Tyr - Thr - Pro - Gln - Ser - Leu - Ala - Thr - Leu - Glu - Ser - Val - Phe - Gln - Glu - Leu - Gly - Lys - Leu - Thr - Gly - Pro - Ser - Asn - Gln - OH |
SecretoneurinAdmin2021-01-15T10:16:47+00:00
