| Product Name | Growth Hormone Releasing Factor, GRF (1-29), amide, human |
| Purity | HPLC>95% |
| Description | This pituitary peptide is isolated from human hypothalamic pituitary tissue. In this GRF fragment of 1 to 29 amino acids, 13 to 21 amino acids are more important than 24 to 29 amino acids for high-affinity receptor binding. Structure-activity studies show that hpGRF(1-29)-NH2 has complete intrinsic activity and effectiveness as a full-length GRF to stimulate growth hormone release in vitro. Human GRF (1-29) has a high degree of homology (>93%) with procine, cattle and sheep GRF (1-29)-NH2. |
| Storage | -20°C |
| References | Ling, N. et al. Proc Natl Acad Sci USA 81, 4302 (1984) Gaudreau, P. et al. J Med Chem 35, 1864 (1992), doi: 10.1021/jm00088a023 Lance, VA. et al. Biochem Biophys Res Commun 119, 265 (1984), doi: 10.1016/0006-291X(84)91647-4 Lapierre, H. et al. Domest Anim Endocrinol 4, 207 (1987) Mayo, KE. et al. Nature 306, 86 (1983) Rivier, J. et al. Nature 300, 276 (1982), doi:10.1038/300276a0 Grossman, A. et al. Clin Endocrinol (Oxf) 21, 321 (1984) |
| Molecular Weight | 3357.9 |
| Sequence (One-Letter Code) | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Sequence (Three-Letter Code) | H - Tyr - Ala - Asp - Ala - Ile - Phe - Thr - Asn - Ser - Tyr - Arg - Lys - Val - Leu - Gly - Gln - Leu - Ser - Ala - Arg - Lys - Leu - Leu - Gln - Asp - Ile - Met - Ser - Arg - NH2 |
Growth Hormone Releasing Factor, GRF (1-29), amide, humanAdmin2021-01-08T05:19:18+00:00
