| Product Name | PACAP (1-38), amide, human, ovine, rat |
| Purity | HPLC>95% |
| Description | Pituitary adenylate cyclase activating peptide (PACAP) is a member of the vasoactive intestinal peptide/secretin/glucagon family, and its amino acid sequence homology with vasoactive intestinal peptide (VIP) is 68%. PACAP38 is derived from a 176 amino acid precursor (pre-opacap), which is a 38 amino acid polypeptide and was found to be a sheep hypothalamic neuropeptide. The amino acid sequence of PACAP is the same in all mammals, in chickens, frogs, salmon and other species, only 1-3 amino acids are different. It is abundant in the central nervous system and peripheral nervous system, and has many functions. PACAP may act as a parasympathetic nerve and sensory neurotransmitter in pancreatic islets. PACAP stimulates pancreatic islets to secrete insulin in a glucose-dependent manner, and its role is an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides that regulate innate immunity and adaptive immunity. VIP/PACAP protects T cells from activation-induced cell death by down-regulating Fas ligand. PACAP immunoreactivity was also found in the nerve fibers of the ganglia and pancreatic islets in the pancreas. It is known that PACAP (1-38) stimulates adenylate cyclase to a much greater extent than VIP. |
| Storage | -20°C |
| References | Ref: Miyata, A. et al. BBRC 173, 1271 (1990). |
| Molecular Weight | 4534.3 |
| Sequence (One-Letter Code) | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| Sequence (Three-Letter Code) | H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2 |
PACAP (1-38), amide, human, ovine, ratAdmin2021-01-08T04:26:38+00:00
