| Product Name | PACAP (1-27), amide, human, ovine, rat |
| Purity | HPLC>95% |
| Description | PACAP-27 is the N-terminal fragment of PACAP-38, a neuropeptide originally isolated from bovine hypothalamus, but it also exists in humans and rats. It has considerable homology with vasoactive intestinal peptide (VIP), but its stimulating effect on adenylate cyclase is much stronger than VIP. PACAP27 and PACAP38 stimulate the accumulation of cAMP through the type I PACAP receptor and increase [Ca2+]i. |
| Storage | -20°C |
| References | Ref: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996). |
| Molecular Weight | 3147.7 |
| Sequence (One-Letter Code) | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
| Sequence (Three-Letter Code) | H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - NH2 |
PACAP (1-27), amide, human, ovine, ratAdmin2021-01-08T03:34:18+00:00
