| Product Name | Galanin, human |
| Purity | HPLC>95% |
| Description | Galanin is a 29 or 30 (human body) amino acid neuropeptide that exists in the central and peripheral nervous systems and has a variety of important physiological activities. These effects are mediated through different G protein coupled receptors. |
| Storage | -20°C |
| References | Ref: Wang, S. et al. J. Biol. Chem. 272, 31949 (1997). |
| Molecular Weight | 3157.5 |
| Sequence (One-Letter Code) | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Sequence (Three-Letter Code) | H - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - OH |
Galanin, humanAdmin2021-01-08T02:39:20+00:00
