| Product Name | Peptide YY (3-36), human |
| Purity | HPLC>95% |
| Description | This peptide is a kind of PYY(3-36), a Y2R agonist, which is released from the gastrointestinal tract in proportion to the calorie content of the meal after a meal, which can inhibit food intake |
| Storage | -20°C |
| References | Ref: Grandt, D. et al. Regul. Peptides 40, 161 (1992); Batterham, R. et al. Nature. 418, 650 (2002). |
| Molecular Weight | 4049.5 |
| Sequence (One-Letter Code) | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Sequence (Three-Letter Code) | H - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2 |
Peptide YY (3-36), humanAdmin2021-01-07T08:54:16+00:00
