| Product Name | Pancreatic Polypeptide, human |
| Purity | HPLC>95% |
| Description | Pancreatic Polypeptide (PP) is a 36 amino acid anorectic peptide hormone secreted by pancreatic PP cells. It is released quickly after a meal and continues to rise for about 4-6 hours after a meal. PP regulates food intake, but it does not exist in children with Prader-Willi syndrome. The secretion of PP can be achieved by electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and gastrin seem to be involved in its secretion, while growth hormone and obestatin have been reported to inhibit its release. PP is related to peptide YY and neuropeptide Y (NPY). |
| Storage | -20°C |
| References | Williams, JA. Pancreapedia (2014), doi: 10.3998/panc.2014.4 Khandekar, N. et al. Mol Cell Endocrinol (2015), doi: 10.1016/j.mce.2015.06.028 |
| Molecular Weight | 4181.8 |
| Sequence (One-Letter Code) | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Sequence (Three-Letter Code) | H - Ala - Pro - Leu - Glu - Pro - Val - Tyr - Pro - Gly - Asp - Asn - Ala - Thr - Pro - Glu - Gln - Met - Ala - Gln - Tyr - Ala - Ala - Asp - Leu - Arg - Arg - Tyr - Ile - Asn - Met - Leu - Thr - Arg - Pro - Arg - Tyr - NH2 |
Pancreatic Polypeptide, humanAdmin2021-01-07T08:50:19+00:00
