| Product Name | Glucagon-Like Peptide 1, GLP-1 (7-37) |
| Purity | HPLC>95% |
| Description | GLP-1(7-37) is an insulin-stimulating hormone, which can cause glucose-dependent release of insulin by pancreatic cells. It is a cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) are involved in gastric motility (gastric emptying), inhibit plasma glucagon levels (glucose production), and may promote it independently of insulin action Peripheral tissues feel full and stimulate glucose processing. Although GLP-1 (7-37) has biological activity, its content is lower than GLP-1 (7-36), and it is not amidated |
| Storage | -20°C |
| References | Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002) Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001) Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004) Rothstein, JD. et al. Neuron 16, 675 (1996) |
| Molecular Weight | 3355.7 |
| Sequence (One-Letter Code) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Sequence (Three-Letter Code) | H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH |
Glucagon-Like Peptide 1, GLP-1 (7-37)Admin2021-01-07T08:41:58+00:00
