| Product Name | Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human |
| Purity | HPLC>95% |
| Description | GLP-1 (7-36) amide is an endocrine hormone that causes insulin-dependent release through pancreatic β cells. It is a cleavage product of GLP-1 (1-36) amide peptide. GLP-1 (7-36) and GLP-1 (7-37) are also gastric motility (gastric emptying), suppress plasma glucagon levels (glucose production) and may promote the satisfaction of glucose processing in peripheral tissues And stimulating effect, independent of insulin action. GLP-1 (7-36) has a short half-life of less than 2 minutes. Like GIP, it is rapidly produced by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed at multiple sites including small intestinal arteriole endothelial cells. degradation. DPP-4 degrades GLP-1 (7-36) into non-insulin GLP-1 (9-36) (some studies indicate that it may have weak insulin sensitizing activity). As a result, GLP-1 (and GIP) is mostly inactivated as an insulin tropism before reaching the systemic circulation. |
| Storage | -20°C |
| References | Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7 Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229 Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197 |
| Molecular Weight | 3297.7 |
| Sequence (One-Letter Code) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Sequence (Three-Letter Code) | H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2 |
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, humanAdmin2021-01-07T08:38:15+00:00
