| Product Name | Glucagon (1-29), bovine, human, porcine, FAM-labeled |
| Purity | HPLC>95% |
| Description | This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia. |
| Storage | -20°C |
| References | O'Harte. FP. et. al. Mol Cell Endocrinol 381, 26 (2013), doi: 10.1016/j.mce.2013.07.014 Drucker DJ. Endocrinology: Adult and Pediatric (7th Ed.) 1, 586 (2016), doi:10.1016/B978-0-323-18907-1.00034-2 |
| Molecular Weight | 3841.1 |
| Sequence (One-Letter Code) | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
| Sequence (Three-Letter Code) | FAM - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - OH |
Glucagon (1-29), bovine, human, porcine, FAM-labeledAdmin2021-01-07T07:24:28+00:00
