| Product Name | GIP (3-42), human |
| Purity | HPLC>95% |
| Description | This peptide is a long GIP (glucose-dependent insulinotropic polypeptide or gastric inhibitory polypeptide) composed of a full length of 42 amino acids with amino acids 3-42. The first two N-terminal amino acids (Tyr-Ala) are degraded by dipeptidyl peptidase IV (DPP-IV) in the body, making GIP (3-42) an effective antagonist, rather than the full-on GIP receptor. Long GIP |
| Storage | -20°C |
| References | Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525 |
| Molecular Weight | 4759.4 |
| Sequence (One-Letter Code) | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Sequence (Three-Letter Code) | H - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH |
GIP (3-42), humanAdmin2021-01-07T07:13:50+00:00
