| Product Name | Exendin 4 |
| Purity | HPLC>95% |
| Description | Exendin-4 is an agonist of the glucagon-like peptide 1 (GLP-1) receptor, which induces the release of insulin after eating. Exendin-4 has 53% sequence homology with GLP-1. Exendin-4 has a longer half-life in plasma than GLP-1, so it is a stronger insulinotropic agent |
| Storage | -20°C |
| References | Eng, J. et al. J Biol Chem 267, 7402 (1992) Greig, NH. et al. Diabetolog 42, 45 (1999) Göke R. et al. J Biol Chem 268, 19650 (1993) |
| Molecular Weight | 4186.6 |
| Sequence (One-Letter Code) | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Sequence (Three-Letter Code) | H - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |
Exendin 4Admin2021-01-07T07:09:22+00:00
