| Product Name | SARS-CoV-2 Spike RBD (receptor binding domain), 395-430 |
| Purity | HPLC>95% |
| Description | The peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from RefSeq (YP_009724390.1) of the SARS-CoV-2 protein |
| Storage | -20°C |
| References | 1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). 2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17 |
| Molecular Weight | |
| Sequence (One-Letter Code) | VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT |
| Sequence (Three-Letter Code) | H - Val - Tyr - Ala - Asp - Ser - Phe - Val - Ile - Arg - Gly - Asp - Glu - Val - Arg - Gln - Ile - Ala - Pro - Gly - Gln - Thr - Gly - Lys - Ile - Ala - Asp - Tyr - Asn - Tyr - Lys - Leu - Pro - Asp - Asp - Phe - Thr - OH |
SARS-CoV-2 Spike RBD (receptor binding domain), 395-430Admin2021-01-07T05:45:31+00:00
