| Product Name | TAT-NSF700scr |
| Purity | HPLC>95% |
| Description | The human immunodeficiency virus (HIV) transcription transactivator (TAT) N-ethylmaleimide sensitive factor (NSF) 700scr peptide was used as a control peptide for the TAT-NSF700 peptide. Compared with TAT-NSF700, it does not inhibit the decomposition activity of NSF, and TAT-NSF700 plays a key role in regulating exocytosis |
| Storage | -20°C |
| References | Morrell, C. et al. JPET 314, 155 (2005) |
| Molecular Weight | 4109.9 |
| Sequence (One-Letter Code) | YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL |
| Sequence (Three-Letter Code) | H - Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Gly - Ile - Pro - Pro - Val - Tyr - Phe - Ser - Arg - Leu - Asp - Leu - Asn - Leu - Val - Val - Leu - Leu - Leu - Ala - Gln - Leu - OH |
TAT-NSF700scrAdmin2021-01-06T10:27:01+00:00
