| Product Name | Tat-Beclin-1, scrambled |
| Purity | HPLC>95% |
| Description | The Beclin-1 peptide is the HIV-1 nef binding part of the full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy-inducing factor, which may trigger cell adaptation, survival or death. When combined with the cell permeability peptide, it can successfully enter the cell and induce autophagy. Tat-Beclin-1, scrambling will not induce autophagy, can be used as a negative control |
| Storage | -20°C |
| References | Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012) |
| Molecular Weight | 3741.1 |
| Sequence (One-Letter Code) | YGRKKRRQRRRGGVGNDFFINHETTGFATEW |
| Sequence (Three-Letter Code) | Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Val - Gly - Asn - His - Phe - Phe - Ile - Asn - His - Ser - Thr - Thr - Gly - Phe - Ala - Thr - Gln - Trp - OH |
Tat-Beclin-1, scrambledAdmin2021-01-06T09:54:23+00:00
