| Product Name | Tat-Beclin-1 |
| Purity | HPLC>95% |
| Description | The Beclin-1 peptide is the HIV-1 nef binding part of the full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy-inducing factor, which may trigger cell adaptation, survival or death. When combined with cell permeability peptide, it can successfully enter the cell and induce autophagy |
| Storage | -20°C |
| References | Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012). |
| Molecular Weight | 3741.1 |
| Sequence (One-Letter Code) | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Sequence (Three-Letter Code) | Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Thr - Asn - Val - Phe - Asn - Ala - Thr - Phe - Glu - Ile - Trp - His - Asp - Gly - Glu - Phe - Gly - Thr - OH |
Tat-Beclin-1Admin2021-01-06T09:53:27+00:00
