| Product Name | Big Endothelin 1 (1-39), porcine |
| Purity | HPLC>95% |
| Description | This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells. |
| Storage | -20°C |
| References | Xu D. et al. Cell, 78(3):473-484 (1994). |
| Molecular Weight | 4384.1 |
| Sequence (One-Letter Code) | CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11) |
| Sequence (Three-Letter Code) | H - Cys - Ser - Cys - Ser - Ser - Leu - Met - Asp - Lys - Glu - Cys - Val - Tyr - Phe - Cys - His - Leu - Asp - Ile - Ile - Trp - Val - Asn - Thr - Pro - Glu - His - Ile - Val - Pro - Tyr - Gly - Leu - Gly - Ser - Pro - Ser - Arg - Ser - OH |
Big Endothelin 1 (1-39), porcineAdmin2021-01-04T12:10:20+00:00
