| Product Name | β-Amyloid (1-46) |
| Purity | HPLC>95% |
| Description | Precursor of the secreted amyloid β-protein (1-40) and (1-42). The identification of amyloid-β-protein (1-46) led to the identification of a zeta-cleavage site between the known γ- and ε-cleavage sites within the transmembrane domain of amyloid-β precursor protein (APP). |
| Storage | -20°C |
| References | G.Zhao et al., J. Biol. Chem., 280, 37689 (2005) Y.Qi-Takahara et al., J. Neurosci., 25, 436 (2005) G.Zhao et al., J. Biol. Chem., 279, 50647 (2004) |
| Molecular Weight | 4926.63 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV |
| Sequence (Three-Letter Code) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-OH |
β-Amyloid (1-46)Admin2020-12-18T13:15:14+00:00
