| Product Name | Beta-Amyloid (1-33), Human |
| Purity | HPLC>95% |
| Description | Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects. |
| Storage | -20°C |
| References | Carvalho, K. et al. Braz. J. Med. Biol. Res. 30, 1153 (1997); Maddalena, A. et al. Neurodegenerative Dis. 1, 231 (2004). |
| Molecular Weight | 3674 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - OH |
Beta-Amyloid (1-33), HumanAdmin2020-12-18T12:40:07+00:00
