| Product Name | Beta-Amyloid (11-40), Human |
| Purity | HPLC>95% |
| Description | Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important. |
| Storage | -20°C |
| References | Huse, JT. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002). |
| Molecular Weight | 3151.7 |
| Sequence (One-Letter Code) | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (Three-Letter Code) | H - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |
Beta-Amyloid (11-40), HumanAdmin2020-12-18T13:25:56+00:00
