| Product Name | Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Human |
| Purity | HPLC>95% |
| Description | This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine. |
| Storage | -20°C |
| References | |
| Molecular Weight | 3616 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2 |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Lys(Biotin) - NH2 |
Beta-Amyloid (1-28)-Lys(Biotin)-NH2, HumanAdmin2020-12-18T12:39:35+00:00
